1. Notes: 29 / 1 year ago  from thesarrruh-deactivated20111120
     
  2. Notes

    1. pleasedontletanyoneiknowfindthis reblogged this from wonderlandcode831
    2. wh0remonger reblogged this from wonderlandcode831
    3. awelltraveledlife reblogged this from wonderlandcode831
    4. wahker reblogged this from wonderlandcode831
    5. lotsnlotsoflove reblogged this from wonderlandcode831
    6. 2fbrizz reblogged this from wonderlandcode831
    7. t-w-art reblogged this from wonderlandcode831 and added:
      The Code was my first ever Tumblr crush - come back and post more awesomeness *sigh*
    8. animalitosviolentos reblogged this from wonderlandcode831
    9. caringimpaired reblogged this from wonderlandcode831
    10. randomdefined reblogged this from wonderlandcode831
    11. alone-fly reblogged this from wonderlandcode831
    12. xofu reblogged this from wonderlandcode831
    13. beggi reblogged this from wonderlandcode831
    14. unleashthefuckingbatss reblogged this from gotpasta
avatar_128
 
 
Mr J salutes You !



Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain. In the event that there is still a problem or error with copyrighted material, the break of the copyright is unintentional and noncommercial and the material will be removed immediately upon presented proof.
 
 

Following

forhereyesonlysiddmanoletherosloveyourchaoswhispersinthestarrydarkpeoplefishkeng001conflictingheartkorrasexualdeepervalleygrayskymorningetoystkindieporndisconnessolupulaoibendmeoverhypersexualgirlcomicallyvintagefrenchmilkluxuriousvulgaritymonk3ythingsthatexcitemelibraryvixenroshroshroshvaviewbjornstarchrisabigailseaofsinleashofvixenmarydearmodfetishquote-booktheporcelainlakeyamadatarocivedoancorabeautifullyshewantscleanescapecurvaturebeautifulanddepravedfairelamouriopenrlighterofe22222cuddleblogskin2skinlyricalgraphicsdrewdangerfieldsylvia-tomlynchpinmaquiloguedirtysecretarylacoliflorwattagesassycasroesjekissezsexuallovnlustdebauchettetodayslyricsrelishtheglamourescapist-tendenciessprstrtdisexitmissblackmambaiamnotinloveputhiminpumpstearsoferoseroticintelligencesexyjackfuckhergentlypornoforpoppets
 

Tumblr