1. Notes: 70 / 2 years ago 
     
  2. Notes

    1. play-in-the-rain reblogged this from m-as-tu-vu and added:
      get me alone somewhere quiet and dark…
    2. gladdyoucame reblogged this from wonderlandcode831 and added:
      //gladdyoucame.tumblr.com
    3. magicfaux reblogged this from standingupdespitegreatfalls
    4. standingupdespitegreatfalls reblogged this from closetexhibitionist
    5. sjofn reblogged this from m-as-tu-vu
    6. juaniitaa reblogged this from eternalinfinity
    7. eternalinfinity reblogged this from m-as-tu-vu
    8. strawberryjane reblogged this from m-as-tu-vu
    9. m-as-tu-vu reblogged this from wonderlandcode831
    10. sensualitea reblogged this from m-as-tu-vu
    11. speedsick reblogged this from roesje
    12. loveisdying reblogged this from secretmewantssex
    13. passionmoon reblogged this from wonderlandcode831
    14. secretmewantssex reblogged this from wonderlandcode831
    15. spysqueen reblogged this from wonderlandcode831
    16. antioco reblogged this from sexask
    17. sexask reblogged this from allinone
    18. houseoferotica reblogged this from speedsick
    19. breathlessthoughts reblogged this from stillquiver
    20. curiosasup reblogged this from carnalknowledge
    21. inabliss reblogged this from javelin
    22. roesje reblogged this from lightero
    23. diaspora99 reblogged this from carnalknowledge
    24. carnalknowledge reblogged this from stillquiver
    25. changethescheme reblogged this from speedsick
    26. kissmeholdme reblogged this from speedsick
    27. blackstarsupernova reblogged this from aphilosophywithamythicalmystery
    28. aphilosophywithamythicalmystery reblogged this from allinone
    29. jjfmatsu reblogged this from allinone
    30. allinone reblogged this from fenaist
    31. sugar-hips-ramblings reblogged this from lightero
avatar_128
 
 
Mr J salutes You !



Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain. In the event that there is still a problem or error with copyrighted material, the break of the copyright is unintentional and noncommercial and the material will be removed immediately upon presented proof.
 
 

Following

siddmanstarryhoursbeautifullykorraspasmoletheroskeng001squidintestinesbigfunforhereyesonlymodfetishgrayskymorningindiepornlupulaoiskin2skinlibraryvixenetoystkhypersexualgirlloveyourchaosdisconnessoquote-bookbjornstarthingsthatexcitemeconflictingheartbendmeoverluxuriousvulgarityyamadataroseaofsindeepervalleydrewdangerfieldfrenchmilkmalelighterocurvaturemonk3yvaviewchrisabigailleashofvixencivedoancorabeautifulanddepravedshewantsfe22222sylvia-tomcomicallyvintagelynchpinmarydearmaquilogueroshroshroshdirtysecretarylacoliflorlyricalgraphicswattagesassycascleanescaperoesjecuddleblogkissezsexuallovnlustdebauchetteiopenrtodayslyricsrelishtheglamourescapist-tendenciessprstrtdisexitmissblackmambaiamnotinloveputhiminpumpstearsoferosfairelamoureroticintelligencesexyjackfuckhergentlypeoplefishpornoforpoppets
 

Tumblr