1. Notes: 13 / 2 years ago 
    I dreamt about you last night.
I woke up wishing the kiss happened for real.

    I dreamt about you last night.

    I woke up wishing the kiss happened for real.

     
  2. Notes

    1. ldepaula reblogged this from romanceisdead
    2. danidmk reblogged this from romanceisdead
    3. startswithforever reblogged this from wonderlandcode831
    4. mademoisellencp reblogged this from romanceisdead
    5. romanceisdead reblogged this from wonderlandcode831
    6. sensualities reblogged this from wonderlandcode831
    7. wonderlandcode831 posted this
avatar_128
 
 
Mr J salutes You !



Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain. In the event that there is still a problem or error with copyrighted material, the break of the copyright is unintentional and noncommercial and the material will be removed immediately upon presented proof.
 
 

Following

starryhoursbeautifullysiddmankorraspasmoletheroskeng001squidintestinesbigfunforhereyesonlymodfetishgrayskymorningindiepornlupulaoiskin2skinlibraryvixenetoystkhypersexualgirlloveyourchaosdisconnessoquote-bookbjornstarthingsthatexcitemeconflictingheartbendmeoverluxuriousvulgarityyamadataroseaofsindeepervalleydrewdangerfieldfrenchmilkmalelighterocurvaturemonk3yvaviewchrisabigailleashofvixencivedoancorabeautifulanddepravedshewantsfe22222sylvia-tomcomicallyvintagelynchpinmarydearmaquilogueroshroshroshdirtysecretarylacoliflorlyricalgraphicswattagesassycascleanescaperoesjecuddleblogkissezsexuallovnlustdebauchetteiopenrtodayslyricsrelishtheglamourescapist-tendenciessprstrtdisexitmissblackmambaiamnotinloveputhiminpumpstearsoferosfairelamoureroticintelligencesexyjackfuckhergentlypeoplefishpornoforpoppets
 

Tumblr