1. Notes: 89 / 3 years ago 
    The Place
     
  2. Notes

    1. sinfulhellcat reblogged this from tinkervampmystic
    2. tinkervampmystic reblogged this from eroticintelligence
    3. silverbells-cockleshells reblogged this from eroticintelligence
    4. meandmrsjones reblogged this from eroticintelligence
    5. puellla reblogged this from easilyled
    6. thehappiestboy reblogged this from heyareyougonnafinishthat and added:
      When you’re with someone magnificent, that is how alone and at peace you feel with that person. Wow I’m a homosexual lol
    7. abstracted-reality reblogged this from heyareyougonnafinishthat
    8. heyareyougonnafinishthat reblogged this from bendmeover and added:
      This is too cute .
    9. followcheetahmenll reblogged this from bendmeover
    10. youfeelme reblogged this from bendmeover
    11. thecompanyofwolves reblogged this from thenewromantic
    12. thenewromantic reblogged this from owlcharm
    13. owlcharm reblogged this from bendmeover
    14. it-must-be-love reblogged this from bendmeover
    15. runamuk reblogged this from easilyled and added:
      This reminds me of the fields in Donnybrook in Spring
    16. eroticintelligence reblogged this from easilyled
    17. cantbuyathrill reblogged this from bendmeover
    18. lexroc reblogged this from bendmeover
    19. easilyled reblogged this from wonderlandcode831 and added:
      wonderlandcode831
    20. kopflos reblogged this from bendmeover
    21. mome-raths reblogged this from korraspasm and added:
      wonderlandcode831:The Place
    22. wonderlandcode831 posted this
avatar_128
 
 
Mr J salutes You !



Disclaimer: All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain. In the event that there is still a problem or error with copyrighted material, the break of the copyright is unintentional and noncommercial and the material will be removed immediately upon presented proof.
 
 

Following

starryhoursbeautifullysiddmankorraspasmoletheroskeng001squidintestinesbigfunforhereyesonlymodfetishgrayskymorningindiepornlupulaoiskin2skinlibraryvixenetoystkhypersexualgirlloveyourchaosdisconnessoquote-bookbjornstarthingsthatexcitemeconflictingheartbendmeoverluxuriousvulgarityyamadataroseaofsindeepervalleydrewdangerfieldfrenchmilkmalelighterocurvaturemonk3yvaviewchrisabigailleashofvixencivedoancorabeautifulanddepravedshewantsfe22222sylvia-tomcomicallyvintagelynchpinmarydearmaquilogueroshroshroshdirtysecretarylacoliflorlyricalgraphicswattagesassycascleanescaperoesjecuddleblogkissezsexuallovnlustdebauchetteiopenrtodayslyricsrelishtheglamourescapist-tendenciessprstrtdisexitmissblackmambaiamnotinloveputhiminpumpstearsoferosfairelamoureroticintelligencesexyjackfuckhergentlypeoplefishpornoforpoppets
 

Tumblr